Bt15a precursor (P02758) Protein Card

General Information
Name Bt15a precursor
Organism Conus betulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILVLVATVLLAIQVLVQS
DGEKPLKRRVKQYAAKRL
SALMRGPR
QCTPRNQRCEGDAECCPNLVCKCFTRPDCQSGY
KCDTS
Sequence region
[1-23]signal sequence
[50-87]mature peptideBt15a

References

Internal links
Nucleic acids Conus betulinus conotoxin bt15a mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot B0KZ78
Ncbi ABG01719, B0KZ78

Tools