Em11.10 (P02569) Protein Card

General Information

Name	Em11.10
Organism	Conus emaciatus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Em11.10 precursor (1457)

Classification

Conopeptide class	conotoxin
Gene superfamily	I2 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

CFPPGIYCTPYLPCCWGICCGTCRNVCHLRI(nh2)
Modified residues	position symbol name 32 nh2 C-term amidation
Sequence evidence	nucleic acid level
Average Mass	3484.19
Monoisotopic Mass	3481.47
Isoelectric Point	10.49
Extinction Coefficient [280nm]	8480.00

References

Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links

Protein Precursor	Em11.10 precursor (1457)
Nucleic acids
Structure

External links

Ncbi

P0C252

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023