Fi11.1a (P01421) Protein Card

General Information

Name	Fi11.1a
Organism	Conus figulinus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Notes	The superfamily assignment is not supported by any available data but the cDNA extraction method is based on the conservation of the signal sequence.

Classification

Conopeptide class	conotoxin
Gene superfamily	I1 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

GHVSCGKDGRACDYHADCCNCCLGGICKPSTSWIGCSTNVF lTR
Modified residues	position symbol name 42 l D-leucine
Sequence evidence	nucleic acid level
Average Mass	4632.21
Monoisotopic Mass	4628.91
Isoelectric Point	10.25
Extinction Coefficient [280nm]	6990.00

References

Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links

Nucleic acids
Structure

External links

UniProtKB/Swiss-Prot	P0C256
Ncbi	P0C256

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023