M11.1a (P01420) Protein Card

General Information

Name	M11.1a
Organism	Conus magus (Magus cone)
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type

Classification

Conopeptide class	conotoxin
Gene superfamily	I1 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

GAVPCGKDGRQCRNHADCCNCCPIGTCAPSTNWILPGCSTG QFmTR
Modified residues	position symbol name 44 m D-methionine
Sequence evidence	nucleic acid level
Average Mass	4823.46
Monoisotopic Mass	4819.99
Isoelectric Point	11.53
Extinction Coefficient [280nm]	5500.00

References

Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links

Nucleic acids
Structure

External links

UniProtKB/Swiss-Prot	P0C257
Ncbi	P0C257

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023