Conus textile TeA53P mRNA, complete cds (N00953) Nucleic Acid Card

General Information
Name Conus textile TeA53P mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
gaccctgccgtcatctcagcgcacacttggtaagaagtga
aaaacctttatc
atgcagaaactgacaattctgcttcttg
ttgctgctgtactgatgtcgacccaggccctaaatcaaga
acaacaccaacgggcaaagatcaacttgctttcnaagaga
aagccacctgctgagcgttggtggcggtggggaggatgca
tgctttggtttgggcgttgtacgaaggactcggaatgttg
ttctaatagttgtgaccgaacgtactgcgagttagcgcga
ttcccatcagactgg
tgacatcgccactctcctcttcaga
gacttcaaggcta
Sequence translation MQKLTILLLVAAVLMSTQALNQEQHQRAKINLL?KRKPPA
ERWWRWGGCMLWFGRCTKDSECCSNSCDRTYCELARFPSD
W

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D. and Zhang,B. (0) Hainan O-superfamily peptides

Internal links
Proteins Encoded TeA53 precursor

External links
Ncbi
GenBank DQ141153

Tools