Conus virgo mRNA for four-loop conotoxin prepropeptide, clone 1 (N00861) Nucleic Acid Card

General Information
Name Conus virgo mRNA for four-loop conotoxin prepropeptide, clone 1
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcgtgttgatcatcactgtgctgttcc
tgacggccagtcagctcattacagctgattactccagaga
tcagcggcagtaccgtgcagtgaggttgggagatgaaatg
cggaatttcaaaggtgccagggactgcgggggacaaggtg
aaggttgttatactcaaccttgctgccctggtctgcggtg
ccgtggcggcggtactggaggaggcgtatgccagctg
tag
Sequence translation MKLTCVLIITVLFLTASQLITADYSRDQRQYRAVRLGDEM
RNFKGARDCGGQGEGCYTQPCCPGLRCRGGGTGGGVCQL

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Proteins Encoded Vi6.1 precursor

External links
Ncbi
GenBank AJ851182

Tools