Conus textile conotoxin Gla-TxX precursor, mRNA, complete cds (N00846) Nucleic Acid Card

General Information
Name Conus textile conotoxin Gla-TxX precursor, mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
cgcccgggcaggtcttcacttgaggagtgcaacaggatct
gagaagagtttggacttccacaataacgtgaactagctgc
ggtcaacagcaag
atgtccggtcatacgtcagtcagtttt
cttctgctctccatcgtggctcttggcatggtggcgacgg
ttatttgctcgtgtgactcggaattctcgagtgaattctg
tgaacggccggaagaaagctgctcgtgctccactcatacg
tgctgtcactgggccagaagggatcagtgtatgaaaccgc
aaaggtgcatctctgcgcaaaaaggaaatggtcgccgcag
attgattcatatgcaaaaa
tgattccatcgtatgccacgt
gatcttgccaacttgtctgtgtgacaagtgttgcagagag
ctgacaccaaatccttgggattcccttaccgaagttttgc
tgtcccccgtttttccctcagctgttgagctgatcaatta
gggactccgccaccatctatacatcgctgacagcaacaaa
cctgcaaattctacatgtacctggttcatctttcattcgg
ctccatttattattgatttcagtcttcttgatattcttca
gctgtcagcggttcttgtcttttttcagtacaaagatatt
tcttgaagtgtatattgaagttaaaaaacagcgataataa
aatctttgacagcata
Sequence translation MSGHTSVSFLLLSIVALGMVATVICSCDSEFSSEFCERPE
ESCSCSTHTCCHWARRDQCMKPQRCISAQKGNGRRRLIHM
QK

References

Internal links
Proteins Encoded TxX precursor

External links
Ncbi
GenBank AY856069

Tools