C.textile KK-1 mRNA for conotoxin (N00005) Nucleic Acid Card

General Information
Name C.textile KK-1 mRNA for conotoxin
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
aaacatcaccaag
atgaaactgacgtgcatgatgatcgtt
gctgtgctgttcttgaccgcctggacattcgccacggctg
atgactccagcaatggattggagaatcttttttcgaaggc
acatcacgaaatgaagaaccccgaagcctctaaattgaac
aagaggtgcattgaacaatttgatccttgtgaaatgatac
gtcacacttgctgcgttggcgtgtgctttctaatggcctg
catc
taaaactgccgtgatgtcttctactcccctcctgtg
ctacctgatctgtgattggcgtggctttcactggttaatg
aacccccctgatccgactctctggaggctcgggggttcaa
catccaaataaagcgacag
Sequence translation MKLTCMMIVAVLFLTAWTFATADDSSNGLENLFSKAHHEM
KNPEASKLNKRCIEQFDPCEMIRHTCCVGVCFLMACI

References
Woodward,S.R., Cruz,L.J., Olivera,B.M. and Hillyard,D.R. (1990) Constant and hypervariable regions in conotoxin propeptides EMBO J. 9:1015-1020

Internal links
Proteins Encoded King-Kong 1 precursor

External links
Ncbi
GenBank X53284

Tools