TxID precursor gene, partial (N02857) Nucleic Acid Card

General Information
Name TxID precursor gene, partial
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes The GenBank card mentions that this peptide is called TxIC but Luo et al. 2013 published it under the name TxID.

Sequence
TTTGATGGCAGGAATGCTGCAGGCAACGACAAAATGTCCG
CCCTGATGGCTCTGACCACCAGGGGATGCTGTTCCCATCC
TGTCTGTAGCGCGATGAGTCCAATCTGTGGCTGA
AGACGC
TGATGCTCCAGGACCCTCTGAACCACGAC
Sequence translation FDGRNAAGNDKMSALMALTTRGCCSHPVCSAMSPICG-

References
Luo,S., Zhangsun,D., Zhu,X., Wu,Y., Hu,Y., Christensen,S., Harvey,P.J., Akcan,M., Craik,D.J. and McIntosh,J.M. (2013) Characterization of a novel α-conotoxin TxID from Conus textile that potently blocks rat α3β4 nicotinic acetylcholine receptors. J. Med. Chem. 56:9655-9663

Internal links
Proteins Encoded TxID precursor

External links
Ncbi
GenBank HF543950

Tools