Conus striatus A superfamily conotoxin S1.1a precursor, gene, complete cds. (N02520) Nucleic Acid Card

General Information
Name Conus striatus A superfamily conotoxin S1.1a precursor, gene, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcactgtgtttctgttggttgtcttggcaatcactg
tcgtttccttccctttagatcgtggtaagtcaatatccga
attctcagtttttgtaacctggagacagtctgcatttgtt
gctttgaaccgtagtgcactgcactgtatttcgttgcatt
gctttgcagtaaggtgttgtgctgtgtactggtctttgct
atgttcttctgtattgtagtgaatcatgctgttctgtaaa
cttttaactgcattgcattgtagtttactgcgttgtagag
aatcatgttgccgtgtgctgtatttgaagtgtattgcact
aacatgtgttgtgtttctgtaaagcatgatgcttaccgtt
gtattacactgaattaaatgtatatttgtggataatgcta
atttgtatgcatatggtataacactctgtttacattggat
cgtgctagtatttcttcatgcattgctttgtattacagtt
tattacaataagtatattgtgttgtattgatgatgatgtt
tcatattgtactatgctgttttgtttttacagacaatttg
aggacagtcacgccaaaacatgattgtttcattcagctag
ctgaatgagacataaaatcaaaaaacattctaaagtacaa
ttatcgtgtgccctactgttattcttactgatagtacttg
tagcagcagtatcatcaccatcatcatcatcatcatcatc
atcatcatcaccatcatcaccatcatcattactagtagta
ggcaaagtagttgtatttgcagtaataggagcagtactgg
tagtagtacttatatattgcctgtcttcggttaaagacca
agttcatagtgtttgacaatccatactgacatttcaacat
caggcggcttgcttggtacagcagccaaagggctgcctac
tggcgcttcgttaagttgttttcagtgtcgttcaattgct
atcagacattctgttcgtttatttttgtttttttttcaga
tttgttttcaggcagtgcgcgtactatgtgtcatccatac
caacggccaaactggccttctcttctctaagttgataatg
gggttttacatctgtctaagctgttctgtctgtctgtctg
tctgtccatctgtccgttcgtgagagacagagggagagta
catgtgggtgtttgtgcgtgtgtgcgcgcgcgcgcgcgcg
catgtgtgtgtgtgtgtccagaatctgatggcgcgaatgc
cgaagcccgcacccacgatcatgagaagcacgcactggac
cggaatggatgctgtaggaatcctgcctgtgagagccaca
gatgtggttga
Sequence translation MFTVFLLVVLAITVVSFPLDRGKSISEFSVFVTWRQSAFV
ALNRSALHCISLHCFAVRCCAVYWSLLCSSVL--IMLFCK
LLTALHCSLLRCRESCCRVLYLKCIALTCVVFL-SMMLTV
VLH-IKCIFVDNANLYAYGITLCLHWIVLVFLHALLCITV
YYNKYIVLY---CFILYYAVLFLQTI-GQSRQNMIVSFS-
LNET-NQKTF-STIIVCPTVILTDSTCSSSIITIIIIIII
IIITIITIIITSSRQSSCICSNRSSTGSSTYILPVFG-RP
SS-CLTIHTDISTSGGLLGTAAKGLPTGASLSCFQCRSIA
IRHSVRLFLFFFQICFQAVRVLCVIHTNGQTGLLFSKLIM
GFYICLSCSVCLSVCPSVRS-ETEGEYMWVFVRVCARARA
HVCVCVQNLMARMPKPAPTIMRSTHWTGMDAVGILPVRAT
DVV?

References
Wu,Y., Wang,L., Zhou,M., You,Y., Zhu,X., Qiang,Y., Qin,M., Luo,S., Ren,Z. and Xu,A. (2013) Molecular evolution and diversity of Conus peptide toxins, as revealed by gene structure and intron sequence analyses. PLoS ONE 8

Internal links
Proteins Encoded S1.1 precursor

External links
Ncbi
GenBank JX293534

Tools