Conus striatus XV conotoxin S15a precursor, mRNA, complete cds. (N02452) Nucleic Acid Card

General Information
Name Conus striatus XV conotoxin S15a precursor, mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atggagaaacttacaatcctggttcttgttgccactgtcc
tgttggcgatccaggtcctggttcaaagtgatagagaaaa
acctctgaagggaagggtcaaacaatacgcagcgaaacgt
ctcccggcactcatgagagggccacgccaatgcacaccta
agaatcagatctgtgaggaggatggggaatgttgcccaaa
tcttgagtgtaaatgctttaccagacctgattgccagcct
ggttataaatgtagacct
tgatgaccctatgccaccctat
atcaatacatcagagccacaacc
Sequence translation MEKLTILVLVATVLLAIQVLVQSDREKPLKGRVKQYAAKR
LPALMRGPRQCTPKNQICEEDGECCPNLECKCFTRPDCQP
GYKCRP

References

Internal links
Proteins Encoded S15a precursor

External links
Ncbi
GenBank JX293467

Tools