Conus striatus M superfamily MMSK group conopeptide S3-WP01 mRNA, complete cds. (N02136) Nucleic Acid Card

General Information
Name Conus striatus M superfamily MMSK group conopeptide S3-WP01 mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagccttgttgaccatctgtctac
ttctgttttccctaactgctgttccgctggatggagatca
acatgcagaccaacctgcacagcgtctgcaggaccgcatt
ccaactgaagatcatcccttatttgatctcaacaaacggt
gttgcgatgattcggaatgcagctattcatgctggccttg
ctgttatgga
taa
Sequence translation MMSKLGALLTICLLLFSLTAVPLDGDQHADQPAQRLQDRI
PTEDHPLFDLNKRCCDDSECSYSCWPCCYG

References

Internal links
Proteins Encoded S3-WP01 precursor

External links
Ncbi
GenBank JF510883

Tools