Conus textile M superfamily MMSK group conopeptide Tx+Ca3-TP03 mRNA, complete cds. (N02103) Nucleic Acid Card

General Information
Name Conus textile M superfamily MMSK group conopeptide Tx+Ca3-TP03 mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttaaactgggagtcttgttgaccatctgtctcc
ttctgttttcccttaatgctgttccgttggatggagatca
acctgcagaccaacctgcagagcgtctgctggacgacatt
tcatttgaaaataatcccttttatgatcccgccaaacggt
gttgcaggacttgcttcggttgcacaccttgttgtgga
tg
a
Sequence translation MMFKLGVLLTICLLLFSLNAVPLDGDQPADQPAERLLDDI
SFENNPFYDPAKRCCRTCFGCTPCCG

References

Internal links
Proteins Encoded TxIIIC precursor

External links
Ncbi
GenBank JF510806

Tools