Conus striatus M superfamily MLKM group conopeptide S+Bt3-E02 mRNA, complete cds. (N02045) Nucleic Acid Card

General Information
Name Conus striatus M superfamily MLKM group conopeptide S+Bt3-E02 mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaacgctccaactggatgcagatcaacc
tgtagaacgatatgtggaaaacaaacaggacctcaaccca
gatgaacggagcaacttcaggctgcctcttgttaggaggt
gctgtagtgtgtcgatatgccagccgccgccagtgtgtga
atgctgcgct
tag
Sequence translation MLKMGVVLFTFLVLFPLATLQLDADQPVERYVENKQDLNP
DERSNFRLPLVRRCCSVSICQPPPVCECCA

References

Internal links
Proteins Encoded S3-E02 precursor

External links
Ncbi
GenBank JF510689

Tools