Conus textile M superfamily MLKM group conopeptide Tx3-T01 mRNA, complete cds. (N02008) Nucleic Acid Card

General Information
Name Conus textile M superfamily MLKM group conopeptide Tx3-T01 mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgaaaatgggagtggtgctattcatctttctgg
tactgtttcccctggcaacgctccagctggatgcagatca
acctgtagaacgatatgcggagaacaaacagctcctcagc
ccagatgaaaggagggaaatcatattgcatgctctgggga
cgcgatgctgttcttgggatgtgtgcgaccacccgagttg
tacttgctgcggt
tag
Sequence translation MMLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLS
PDERREIILHALGTRCCSWDVCDHPSCTCCG

References

Internal links
Proteins Encoded TxIIIA precursor

External links
Ncbi
GenBank JF510646 (partial), JF510645

Tools