Conus textile M superfamily MLKM group conopeptide Tx3-Q01 mRNA, complete cds. (N01996) Nucleic Acid Card

General Information
Name Conus textile M superfamily MLKM group conopeptide Tx3-Q01 mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcatcttcctggtac
tgtttcccctggcaacgctccagctggatgcagatcaacc
tgtagaacgatatgcggagaacaaacagctcctcaaccca
gatgaaaagaggggaatcctattgcctgctctgaggacgc
gagtatgctgtcctttcggaggctgccacgaactttgtca
atgctgcgagggt
tag
Sequence translation MLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLNP
DEKRGILLPALRTRVCCPFGGCHELCQCCEG

References

Internal links
Proteins Encoded TxMLKM-021 precursor

External links
Ncbi
GenBank JF510630

Tools