Conus textile M superfamily MLKM group conopeptide Tx3-E09 mRNA, complete cds. (N01982) Nucleic Acid Card

General Information
Name Conus textile M superfamily MLKM group conopeptide Tx3-E09 mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgaaaatgggagtggtgctattcatctttctgg
tactgtttcccctggcaacgctccagctggatgcagatca
acctgtagaacgatatgcggagaacaaacagctcctcaac
ccagatgaaaagaggggaatcctattgcctgctctgagga
ggttctgctgtgattcgaattggtgcaacatttcggattg
tgagtgctgctacggt
tag
Sequence translation MMLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLN
PDEKRGILLPALRRFCCDSNWCNISDCECCYG

References

Internal links
Proteins Encoded Tx3-E09 precursor

External links
Ncbi
GenBank JF510615

Tools