S3-I01 mRNA (N01978) Nucleic Acid Card

General Information
Name S3-I01 mRNA
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtgatgctattcacctttctggtcc
tgtttcccctggcaacgctccagctggatgcagatcagcc
tgtagaacgatatgcggaggacaaacaggacctcaaccga
gatgaaaggatgggattcatattgcatgctctgggacagc
ggcaatgctgtgattggccatggtgcgacgactgtatttg
ctgcgat
tag
Sequence translation MLKMGVMLFTFLVLFPLATLQLDADQPVERYAEDKQDLNR
DERMGFILHALGQRQCCDWPWCDDCICCD

References
Zhou,M., Wang,L., Wu,Y., Zhu,X., Feng,Y., Chen,Z., Li,Y., Sun,D., Ren,Z. and Xu,A. (2013) Characterizing the evolution and functions of the M-superfamily conotoxins. Toxicon 76:150-159

Internal links
Proteins Encoded S3-I01 precursor

External links
Ncbi
GenBank JF510611

Tools