Conus radiatus bromosleeper conotoxin O3-superfamily protein mRNA, partial cds. (N01846) Nucleic Acid Card

General Information
Name Conus radiatus bromosleeper conotoxin O3-superfamily protein mRNA, partial cds.
Organism Conus radiatus
Organism Diet piscivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgtcgggattgggattcatggtgctaacccttctacttc
ttacgttcatggcaaccagtcatcaggatagaggagagaa
gcaggcgacgcaaaggcacgcaatcaatgtcataaggaga
agattaatcactcgctgggcaacaattgacgagtgcgaag
agacatgcaacgtgacgtttaagacctgctgcggtccacc
tggagattggcaatgtgtcgaagcatgccccgtg
Sequence translation MSGLGFMVLTLLLLTFMATSHQDRGEKQATQRHAINVIRR
RLITRWATIDECEETCNVTFKTCCGPPGDWQCVEACPV

References

Internal links
Proteins Encoded Bromosleeper peptide precursor

External links
Ncbi
GenBank GQ981406

Tools