Cal22a precursor (N01818) Nucleic Acid Card

General Information
Name Cal22a precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgatgtcaactaaaggaatcacgctgttcctctgcctgc
ttctgttggccctggcaaccagtgttaacggaggtcaagg
cacccgaaggtccaggatgaccagagcactgcacgggggc
agaccaagtgcccgatacgatgccccgtactgttcccagg
aagaggttcgggagtgtcacgatgactgtagcggtaatcc
tgtcagggacgcctgtcagtgtgcctatgacccagcagga
agtccagcgtgtgattgttactgcgtggaaccatggcgac
gttga
Sequence translation MMSTKGITLFLCLLLLALATSVNGGQGTRRSRMTRALHGG
RPSARYDAPYCSQEEVRECHDDCSGNPVRDACQCAYDPAG
SPACDCYCVEPWRR-

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal22a precursor

External links
Ncbi
GenBank GU324074

Tools