Cal6.13 precursor (N01797) Nucleic Acid Card

General Information
Name Cal6.13 precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaattcccactgctcttcatctccctggcgcttgctg
ccttcctcactcgtgtgcaggatgctgactcttcagtaat
ctccaaagagaaatcagtgagagacggtgaagagtttcca
tgtgcgggaacaatggccgactgccgtggtctggccgaca
atagcgtgtgctgtgacactggcaagtgcataggagaagt
gtgctactac
Sequence translation MKFPLLFISLALAAFLTRVQDADSSVISKEKSVRDGEEFP
CAGTMADCRGLADNSVCCDTGKCIGEVCYY

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Cal6.13 precursor

External links
Ncbi
GenBank FJ959145

Tools