Sequence 58 from Patent EP1852440. (N01531) Nucleic Acid Card

General Information
Name Sequence 58 from Patent EP1852440.
Organism Conus magus (Magus cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccttcccttcagatcgtgcatctgatggcaggaa
tgccgcagccaacgacaaagcgtctgacgtgatcacgctg
gccctcaagggatgctgttccaaccctgtctgtcacttgg
agcattcaaacctttgtggtagaagacgc
tgatgctccag
gaccctctgaaccacgacgttcgagca
Sequence translation MFTVFLLVVLATTVVSFPSDRASDGRNAAANDKASDVITL
ALKGCCSNPVCHLEHSNLCGRRR

References
Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links
Proteins Encoded Sequence 58 from Patent EP1852440.

External links
Ncbi
GenBank FB299888

Tools