Conus textile clone TxMEKL-0422 conotoxin scaffold VI/VII precursor, mRNA, partial cds (N00122) Nucleic Acid Card

General Information
Name Conus textile clone TxMEKL-0422 conotoxin scaffold VI/VII precursor, mRNA, partial cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
aatcctgcttcttgttgctcttgtgctgatgtcgacccag
gccgtgcttcaagaaaaacgcccaaaggagaggatcaagt
ttttatcaaagagaaagacagatgc
tgagaagcagcagaa
gcgcctttgcccggattacacgaacccttgttcatatccc
catcaatgctgttcatggaattgttataatgggcactgca
cgggatgaactctgaccacaggccatccgacatcaccact
ctcctcttcagaggcttcaagacttttgttctgattttgg
acaatctttacaagcaaacaaataattagactagcacttt
ttgcccctttgcaaaatcaatgatggaggtaaaaagcctc
ccattatgtcttcatcaataaagaaatgtatcatcataaa
aaaaaa
Sequence translation NPASCCSCADVDPGRASRKTPKGEDQVFIKEKDRC

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded TxMEKL-0422 precursor (scaffold VI/VII)

External links
Ncbi
GenBank AF215022

Tools