Conus litteratus clone 05F07 O superfamily conotoxin lt6d precursor, mRNA, complete cds (N01000) Nucleic Acid Card

General Information
Name Conus litteratus clone 05F07 O superfamily conotoxin lt6d precursor, mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gagaacgtccttgcacggtgagcctgactccatattcctt
catcgtctttttgggcattaccaaaaacatcagtaaa
atg
aaactgacgtgcgtgccgattgtcgccatgctgttcctga
tggcctgtcaactcattacagctgattactctagagagaa
gcacgggtattctgctgagaagtcgagtgacaagattcag
gattccttttactcaaagttgaccaagagatgtacggatg
agggtggtgattgtgatcctggaaatcataactgctgcag
gggatcgtgtcttgttttacaacacaaagccgtctgtggt
atactttatactatggtctcgcgg
taaagagtgaggaagg
ggaatgtgagtgatgtccttatctgcagtaaaatcaatta
atcaatcaaccggtcattcacaaaattaatcaatgaatta
atcagtaaatctatgaaggatcatattatgagcgaggcat
ttttcctccgactgacttgaaataaagagtagcgtgctac
actgaccgttaccagacaaacagcaaaaaaa
Sequence translation MKLTCVPIVAMLFLMACQLITADYSREKHGYSAEKSSDKI
QDSFYSKLTKRCTDEGGDCDPGNHNCCRGSCLVLQHKAVC
GILYTMVSR

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Proteins Encoded Lt6d precursor

External links
Ncbi
GenBank DQ345371

Tools